HPA006566

Immunofluorescence
Anti-TAF6: Cat. No. HPA006566: Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus and cytoplasm.

Image

1 of 2 More...


HPA006566

Sigma

 

Anti-TAF6 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Human Protein Atlas Number:HPA006566 Image Gallery

Related Products

References

Reviews

Description

ApplicationPrestige Antibodies® Powered by Atlas Antibodies are developed and validated by the Human Proteome Resource (HPR) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
ImmunogenTranscription initiation factor TFIID subunit 6 recombinant protein epitope signature tag (PrEST)
 Immunogen sequence: LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG
Physical formSolution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Biotechnology LP and Sigma-Aldrich Co.

Properties

antibody formaffinity isolated antibody
gradePrestige Antibodies® Powered by Atlas Antibodies
formbuffered aqueous glycerol solution
species reactivityhuman
availabilitynot available in Canada (due to temporary import restrictions; for questions or status updates, please email us at antibody.canada@sial.com)
application(s)immunoblotting: suitable
 immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
 protein array: suitable
Gene Informationhuman ... TAF6(6878)
shipped inwet ice
storage temp.−20°C